www.yarravillevillagefarmersmarket.com.au - Detailed Indepth Information and Report for www.yarravillevillagefarmersmarket.com.au server location, www.yarravillevillagefarmersmarket.com.au website speed, www.yarravillevillagefarmersmarket.com.au website DNS lookup, www.yarravillevillagefarmersmarket.com.au Domain Details,www.yarravillevillagefarmersmarket.com.au social account information, etc. Complete Analysis of www.yarravillevillagefarmersmarket.com.au SEO like Meta Tags, Meta Keywords, Description, image count etc.
Web Analysis for yarravillevillagefarmersmarket - www.yarravillevillagefarmersmarket.com.au
| Page URL : | http://www.yarravillevillagefarmersmarket.com.au/ |
|---|---|
| Page Download Size : | 0.2969 Kb |
| Page Load Time : | 0.0273 Sec |
| Download Speed : | 0.0106 Mbps |
During our test, www.yarravillevillagefarmersmarket.com.au was downloaded in 0.0273 seconds. The homepage of the website is of 0.2969 Kb. The homepage was downloaded at the speed of 0.0106 Mbps, which is on the lower side.
Website Rank & Score to yarravillevillagefarmersmarket.com.au by Global & Country
The AuraStats, which measures best global as well country Alexa ranking performace of www.yarravillevillagefarmersmarket.com.au. www.yarravillevillagefarmersmarket.com.au ranks is not applicable. www.yarravillevillagefarmersmarket.com.au is not a top rated website as per Alexa Ranking. The website www.yarravillevillagefarmersmarket.com.au does not rank amongst top 1 million websites globally or in its country.
| Global Alexa Rank | Not Applicable |
|---|---|
| Country Alexa Rank | Not Applicable |
Web Server Information - www.yarravillevillagefarmersmarket.com.au
yarravillevillagefarmersmarket.com.au is hosted on Server 161.202.9.58 in SoftLayer Technologies Inc. Data Center. Approximate latitude and logitude of the IP 161.202.9.58 are 1.2896699905396 and 103.85006713867 respectively. yarravillevillagefarmersmarket.com.au is hosted in Singapore, Singapore, Singapore.
| Hosted IP Address | 161.202.9.58 |
|---|---|
| Hosted Country | Singapore |
| Location Latitude | 1.2896699905396 |
| Location Longitude | 103.85006713867 |
| Server ISP | SoftLayer Technologies Inc. |
| Server Region | Singapore |
| Server City | Singapore |
Page Title of www.yarravillevillagefarmersmarket.com.au
Yarraville Village Farmers Market
Meta Tags of www.yarravillevillagefarmersmarket.com.au
Upon analysing the homepage of www.yarravillevillagefarmersmarket.com.au, we found that no meta keywords were present.
Meta Viewport of www.yarravillevillagefarmersmarket.com.au is Mobile Optimized.
We could not find Meta Author, Meta Generator, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.yarravillevillagefarmersmarket.com.au
| Meta Keywords | Not Applicable |
|---|---|
| Meta Author | Not Applicable |
| Meta Generator | Not Applicable |
| Meta Viewport | Mobile Optimized |
| Meta Framework | Not Applicable |
| Meta Theme Color | Not Applicable |
| Meta MS-App | Not Applicable |
| Meta Format Detection | Not Applicable |
Social Accounts
www.yarravillevillagefarmersmarket.com.au has a facebook page link on its website.
We could not find Youtube URL, Instagram URL, Lindedin URL for www.yarravillevillagefarmersmarket.com.au
| Facebook Link |
|---|
| https://www.facebook.com/201649696524691/photos/a.203179593038368/3609098712446422/ http://www.facebook.com/plugins/likebox.php |
| Youtube Link |
| Not Available |
| Instagram Link |
| Not Available |
| Linkedin Link |
| Not Available |
Contact Information - yarravillevillagefarmersmarket.com.au
| Mobile No |
|---|
| We could not find any Mobile No. for yarravillevillagefarmersmarket.com.au |
| Email ID |
|---|
| We could not find any Email ID for yarravillevillagefarmersmarket.com.au |
Domain TYPOS
Some common domain name typos of yarravillevillagefarmersmarket.com.au are as follows:
Website Inpage Analysis
We didn't find any H1 Tags, H4 Tags, H5 Tags, Audio Tags, Video Tags, Google Adsense, Google Analytics on yarravillevillagefarmersmarket.com.au, however, there are 2 H2 Tags, 9 H3 Tags, 1 H6 Tags, 32 Paragraph Tags, 6 Iframe Tags, 8 Image Tags, 50 Div Tags.
| H1 Heading | Not Applicable |
|---|---|
| H3 Heading | 9 |
| H5 Heading | Not Applicable |
| P Tag | 32 |
| Total IFRAMEs | 6 |
| Audio | Not Applicable |
| Google Adsense | Not Applicable |
| H2 Heading | 2 |
|---|---|
| H4 Heading | Not Applicable |
| H6 Heading | 1 |
| Total Images | 8 |
| Div Tag | 50 |
| Video | Not Applicable |
| Google Analytics | Not Applicable |
HTTP Header Analysis
Following is the HTTP Header Analyis of www.yarravillevillagefarmersmarket.com.au
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| yarravillevillagefarmersmarket.com.au | A | 14392 | IP : 161.202.9.58 |
| yarravillevillagefarmersmarket.com.au | NS | 14392 | Target : ns2.site5.com |
| yarravillevillagefarmersmarket.com.au | NS | 14392 | Target : ns1.site5.com |
| www.yarravillevillagefarmersmarket.com.au | CNAME | 14392 | |
| yarravillevillagefarmersmarket.com.au | SOA | 14392 |
MNAME : ns1.site5.com RNAME : root.reseller401.webserversystems.com Serial : 2019061302 Refresh : 86400 Retry : 7200 Expire : 3600000 Minimum TTL : 86400 |
| yarravillevillagefarmersmarket.com.au | MX | 14392 | Target : mail.yarravillevillagefarmersmarket.com.au |
| yarravillevillagefarmersmarket.com.au | TXT | 14392 | Text : v=spf1 a mx include:websitewelcome.com ~all |