www.yarravillevillagefarmersmarket.com.au - Detailed Indepth Information and Report for www.yarravillevillagefarmersmarket.com.au server location, www.yarravillevillagefarmersmarket.com.au website speed, www.yarravillevillagefarmersmarket.com.au website DNS lookup, www.yarravillevillagefarmersmarket.com.au Domain Details,www.yarravillevillagefarmersmarket.com.au social account information, etc. Complete Analysis of www.yarravillevillagefarmersmarket.com.au SEO like Meta Tags, Meta Keywords, Description, image count etc.

Web Analysis for yarravillevillagefarmersmarket - www.yarravillevillagefarmersmarket.com.au

Page URL : http://www.yarravillevillagefarmersmarket.com.au/
Page Download Size : 0.2969 Kb
Page Load Time : 0.0409 Sec
Download Speed : 0.0071 Mbps

During our test, www.yarravillevillagefarmersmarket.com.au was downloaded in 0.0409 seconds. The homepage of the website is of 0.2969 Kb. The homepage was downloaded at the speed of 0.0071 Mbps, which is on the lower side.

Website Rank & Score to yarravillevillagefarmersmarket.com.au by Global & Country

The AuraStats, which measures best global as well country Alexa ranking performace of www.yarravillevillagefarmersmarket.com.au. www.yarravillevillagefarmersmarket.com.au ranks is not applicable. www.yarravillevillagefarmersmarket.com.au is not a top rated website as per Alexa Ranking. The website www.yarravillevillagefarmersmarket.com.au does not rank amongst top 1 million websites globally or in its country.

Global Alexa Rank

Not Applicable

Country Alexa Rank

Not Applicable

Web Server Information - www.yarravillevillagefarmersmarket.com.au

yarravillevillagefarmersmarket.com.au is hosted on Server 161.202.9.58 in SoftLayer Technologies Inc. Data Center. Approximate latitude and logitude of the IP 161.202.9.58 are 1.2896699905396 and 103.85006713867 respectively. yarravillevillagefarmersmarket.com.au is hosted in Singapore, Singapore, Singapore.

Hosted IP Address

161.202.9.58

Hosted Country

Singapore

Location Latitude

1.2896699905396

Location Longitude

103.85006713867

Server ISP

SoftLayer Technologies Inc.

Server Region

Singapore

Server City

Singapore

Page Title of www.yarravillevillagefarmersmarket.com.au

Yarraville Village Farmers Market

Meta Tags of www.yarravillevillagefarmersmarket.com.au

Upon analysing the homepage of www.yarravillevillagefarmersmarket.com.au, we found that no meta keywords were present.

Meta Viewport of www.yarravillevillagefarmersmarket.com.au is Mobile Optimized.

We could not find Meta Author, Meta Generator, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.yarravillevillagefarmersmarket.com.au

Meta Keywords

Not Applicable

Meta Author

Not Applicable

Meta Generator

Not Applicable

Meta Viewport

Mobile Optimized

Meta Framework

Not Applicable

Meta Theme Color

Not Applicable

Meta MS-App

Not Applicable

Meta Format Detection

Not Applicable

Social Accounts

www.yarravillevillagefarmersmarket.com.au has a facebook page link on its website.

We could not find Youtube URL, Instagram URL, Lindedin URL for www.yarravillevillagefarmersmarket.com.au

Facebook Link
https://www.facebook.com/201649696524691/photos/a.203179593038368/3609098712446422/
http://www.facebook.com/plugins/likebox.php
Youtube Link
Not Available
Instagram Link
Not Available
Linkedin Link
Not Available

Contact Information - yarravillevillagefarmersmarket.com.au

Mobile No
We could not find any Mobile No. for yarravillevillagefarmersmarket.com.au
Email ID
We could not find any Email ID for yarravillevillagefarmersmarket.com.au

Domain TYPOS

Some common domain name typos of yarravillevillagefarmersmarket.com.au are as follows:

Website Inpage Analysis

We didn't find any H1 Tags, H4 Tags, H5 Tags, Audio Tags, Video Tags, Google Adsense, Google Analytics on yarravillevillagefarmersmarket.com.au, however, there are 2 H2 Tags, 9 H3 Tags, 1 H6 Tags, 32 Paragraph Tags, 6 Iframe Tags, 8 Image Tags, 50 Div Tags.

H1 Heading

Not Applicable

H3 Heading

9

H5 Heading

Not Applicable

P Tag

32

Total IFRAMEs

6

Audio

Not Applicable

Google Adsense

Not Applicable

H2 Heading

2

H4 Heading

Not Applicable

H6 Heading

1

Total Images

8

Div Tag

50

Video

Not Applicable

Google Analytics

Not Applicable

HTTP Header Analysis

Following is the HTTP Header Analyis of www.yarravillevillagefarmersmarket.com.au

DNS Record Analysis

Host Type TTL Extra
yarravillevillagefarmersmarket.com.au A 14392 IP : 161.202.9.58
yarravillevillagefarmersmarket.com.au NS 14392 Target : ns2.site5.com
yarravillevillagefarmersmarket.com.au NS 14392 Target : ns1.site5.com
www.yarravillevillagefarmersmarket.com.au CNAME 14392
yarravillevillagefarmersmarket.com.au SOA 14392 MNAME : ns1.site5.com
RNAME : root.reseller401.webserversystems.com
Serial : 2019061302
Refresh : 86400
Retry : 7200
Expire : 3600000
Minimum TTL : 86400
yarravillevillagefarmersmarket.com.au MX 14392 Target : mail.yarravillevillagefarmersmarket.com.au
yarravillevillagefarmersmarket.com.au TXT 14392 Text : v=spf1 a mx include:websitewelcome.com ~all