www.automaticfiresprinklersvc.com - Detailed Indepth Information and Report for www.automaticfiresprinklersvc.com server location, www.automaticfiresprinklersvc.com website speed, www.automaticfiresprinklersvc.com website DNS lookup, www.automaticfiresprinklersvc.com Domain Details,www.automaticfiresprinklersvc.com social account information, etc. Complete Analysis of www.automaticfiresprinklersvc.com SEO like Meta Tags, Meta Keywords, Description, image count etc.

Web Analysis for automaticfiresprinklersvc - www.automaticfiresprinklersvc.com

Page URL : http://www.automaticfiresprinklersvc.com/
Page Download Size : 0.0156 Kb
Page Load Time : 0.0317 Sec
Download Speed : 0.0005 Mbps

Automatic Fire Sprinkler Service - A full Service Fire Sprinkler Company.During our test, www.automaticfiresprinklersvc.com was downloaded in 0.0317 seconds. The homepage of the website is of 0.0156 Kb. The homepage was downloaded at the speed of 0.0005 Mbps, which is on the lower side.

Website Rank & Score to automaticfiresprinklersvc.com by Global & Country

The AuraStats, which measures best global as well country Alexa ranking performace of www.automaticfiresprinklersvc.com. www.automaticfiresprinklersvc.com ranks is not applicable. www.automaticfiresprinklersvc.com is not a top rated website as per Alexa Ranking. The website www.automaticfiresprinklersvc.com does not rank amongst top 1 million websites globally or in its country.

Global Alexa Rank

Not Applicable

Country Alexa Rank

Not Applicable

Web Server Information - www.automaticfiresprinklersvc.com

automaticfiresprinklersvc.com is hosted on Server 199.34.228.59 in Weebly Inc. Data Center. Approximate latitude and logitude of the IP 199.34.228.59 are 37.775699615479 and -122.39520263672 respectively. automaticfiresprinklersvc.com is hosted in San Francisco, California, United States.

Hosted IP Address

199.34.228.59

Hosted Country

United States

Location Latitude

37.775699615479

Location Longitude

-122.39520263672

Server ISP

Weebly Inc.

Server Region

California

Server City

San Francisco

Page Title of www.automaticfiresprinklersvc.com

Staten Island Fire Safety Automatic Fire Sprinkler - Home

Meta Tags of www.automaticfiresprinklersvc.com

Upon analysing the homepage of www.automaticfiresprinklersvc.com, we found the following meta keywords - Fire Sprinkler, Testing, Installations, Inspections, Repairs, Maintenance, Systems, Supplies, Fire Safety Protection, Fire Protection, Fire Sprinkler Systems, Fire Suppression, Service, FDNY, Violation Removal, Fire Department, Danielle Louise, si, ny,nyc.

We could not find Meta Author, Meta Generator, Meta Viewport, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.automaticfiresprinklersvc.com

Meta Keywords

Fire Sprinkler, Testing, Installations, Inspections, Repairs, Maintenance, Systems, Supplies, Fire Safety Protection, Fire Protection, Fire Sprinkler Systems, Fire Suppression, Service, FDNY, Violation Removal, Fire Department, Danielle Louise, si, ny,nyc

Meta Author

Not Applicable

Meta Generator

Not Applicable

Meta Viewport

Not Applicable

Meta Framework

Not Applicable

Meta Theme Color

Not Applicable

Meta MS-App

Not Applicable

Meta Format Detection

Not Applicable

Social Accounts

www.automaticfiresprinklersvc.com has a facebook page link on its website.

We could not find Youtube URL, Instagram URL, Lindedin URL for www.automaticfiresprinklersvc.com

Facebook Link
facebook.com/AutomaticFireSprinklerService
Youtube Link
Not Available
Instagram Link
Not Available
Linkedin Link
Not Available

Contact Information - automaticfiresprinklersvc.com

Mobile No
We could not find any Mobile No. for automaticfiresprinklersvc.com
Email ID
We found the some Email ID for automaticfiresprinklersvc.com are as follows.
john@automaticfiresprinkler.netsifiresafety999

Domain TYPOS

Some common domain name typos of automaticfiresprinklersvc.com are as follows:

Website Inpage Analysis

We didn't find any H1 Tags, H3 Tags, H4 Tags, H5 Tags, H6 Tags, Paragraph Tags, Iframe Tags, Audio Tags, Video Tags, Google Adsense on automaticfiresprinklersvc.com, however, there are 2 H2 Tags, 2 Image Tags, 60 Div Tags, and Google Analytics available.

H1 Heading

Not Applicable

H3 Heading

Not Applicable

H5 Heading

Not Applicable

P Tag

Not Applicable

Total IFRAMEs

Not Applicable

Audio

Not Applicable

Google Adsense

Not Applicable

H2 Heading

2

H4 Heading

Not Applicable

H6 Heading

Not Applicable

Total Images

2

Div Tag

60

Video

Not Applicable

Google Analytics

AVAILABLE

HTTP Header Analysis

Following is the HTTP Header Analyis of www.automaticfiresprinklersvc.com

DNS Record Analysis

Host Type TTL Extra
automaticfiresprinklersvc.com A 3597 IP : 199.34.228.59
automaticfiresprinklersvc.com NS 3597 Target : ns34.domaincontrol.com
automaticfiresprinklersvc.com NS 3597 Target : ns33.domaincontrol.com
www.automaticfiresprinklersvc.com CNAME 3597
automaticfiresprinklersvc.com SOA 3597 MNAME : ns33.domaincontrol.com
RNAME : dns.jomax.net
Serial : 2016050400
Refresh : 28800
Retry : 7200
Expire : 604800
Minimum TTL : 600
automaticfiresprinklersvc.com MX 3597 Target : smtp.secureserver.net
automaticfiresprinklersvc.com MX 3597 Target : mailstore1.secureserver.net
automaticfiresprinklersvc.com TXT 3597 Text : google-site-verification=vLYC_SE9o0XHandZXA7WKNkHCPHeWS8IloqpT-T0EWg