www.automaticfiresprinklersvc.com - Detailed Indepth Information and Report for www.automaticfiresprinklersvc.com server location, www.automaticfiresprinklersvc.com website speed, www.automaticfiresprinklersvc.com website DNS lookup, www.automaticfiresprinklersvc.com Domain Details,www.automaticfiresprinklersvc.com social account information, etc. Complete Analysis of www.automaticfiresprinklersvc.com SEO like Meta Tags, Meta Keywords, Description, image count etc.
Web Analysis for automaticfiresprinklersvc - www.automaticfiresprinklersvc.com
| Page URL : | http://www.automaticfiresprinklersvc.com/ |
|---|---|
| Page Download Size : | 0.0156 Kb |
| Page Load Time : | 0.0317 Sec |
| Download Speed : | 0.0005 Mbps |
Automatic Fire Sprinkler Service - A full Service Fire Sprinkler Company.During our test, www.automaticfiresprinklersvc.com was downloaded in 0.0317 seconds. The homepage of the website is of 0.0156 Kb. The homepage was downloaded at the speed of 0.0005 Mbps, which is on the lower side.
Website Rank & Score to automaticfiresprinklersvc.com by Global & Country
The AuraStats, which measures best global as well country Alexa ranking performace of www.automaticfiresprinklersvc.com. www.automaticfiresprinklersvc.com ranks is not applicable. www.automaticfiresprinklersvc.com is not a top rated website as per Alexa Ranking. The website www.automaticfiresprinklersvc.com does not rank amongst top 1 million websites globally or in its country.
| Global Alexa Rank | Not Applicable |
|---|---|
| Country Alexa Rank | Not Applicable |
Web Server Information - www.automaticfiresprinklersvc.com
automaticfiresprinklersvc.com is hosted on Server 199.34.228.59 in Weebly Inc. Data Center. Approximate latitude and logitude of the IP 199.34.228.59 are 37.775699615479 and -122.39520263672 respectively. automaticfiresprinklersvc.com is hosted in San Francisco, California, United States.
| Hosted IP Address | 199.34.228.59 |
|---|---|
| Hosted Country | United States |
| Location Latitude | 37.775699615479 |
| Location Longitude | -122.39520263672 |
| Server ISP | Weebly Inc. |
| Server Region | California |
| Server City | San Francisco |
Page Title of www.automaticfiresprinklersvc.com
Staten Island Fire Safety Automatic Fire Sprinkler - Home
Meta Tags of www.automaticfiresprinklersvc.com
Upon analysing the homepage of www.automaticfiresprinklersvc.com, we found the following meta keywords - Fire Sprinkler, Testing, Installations, Inspections, Repairs, Maintenance, Systems, Supplies, Fire Safety Protection, Fire Protection, Fire Sprinkler Systems, Fire Suppression, Service, FDNY, Violation Removal, Fire Department, Danielle Louise, si, ny,nyc.
We could not find Meta Author, Meta Generator, Meta Viewport, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.automaticfiresprinklersvc.com
| Meta Keywords | Fire Sprinkler, Testing, Installations, Inspections, Repairs, Maintenance, Systems, Supplies, Fire Safety Protection, Fire Protection, Fire Sprinkler Systems, Fire Suppression, Service, FDNY, Violation Removal, Fire Department, Danielle Louise, si, ny,nyc |
|---|---|
| Meta Author | Not Applicable |
| Meta Generator | Not Applicable |
| Meta Viewport | Not Applicable |
| Meta Framework | Not Applicable |
| Meta Theme Color | Not Applicable |
| Meta MS-App | Not Applicable |
| Meta Format Detection | Not Applicable |
Social Accounts
www.automaticfiresprinklersvc.com has a facebook page link on its website.
We could not find Youtube URL, Instagram URL, Lindedin URL for www.automaticfiresprinklersvc.com
| Facebook Link |
|---|
| facebook.com/AutomaticFireSprinklerService |
| Youtube Link |
| Not Available |
| Instagram Link |
| Not Available |
| Linkedin Link |
| Not Available |
Contact Information - automaticfiresprinklersvc.com
| Mobile No |
|---|
| We could not find any Mobile No. for automaticfiresprinklersvc.com |
| Email ID |
|---|
| We found the some Email ID for automaticfiresprinklersvc.com are as follows. |
| john@automaticfiresprinkler.netsifiresafety999 |
Domain TYPOS
Some common domain name typos of automaticfiresprinklersvc.com are as follows:
Website Inpage Analysis
We didn't find any H1 Tags, H3 Tags, H4 Tags, H5 Tags, H6 Tags, Paragraph Tags, Iframe Tags, Audio Tags, Video Tags, Google Adsense on automaticfiresprinklersvc.com, however, there are 2 H2 Tags, 2 Image Tags, 60 Div Tags, and Google Analytics available.
| H1 Heading | Not Applicable |
|---|---|
| H3 Heading | Not Applicable |
| H5 Heading | Not Applicable |
| P Tag | Not Applicable |
| Total IFRAMEs | Not Applicable |
| Audio | Not Applicable |
| Google Adsense | Not Applicable |
| H2 Heading | 2 |
|---|---|
| H4 Heading | Not Applicable |
| H6 Heading | Not Applicable |
| Total Images | 2 |
| Div Tag | 60 |
| Video | Not Applicable |
| Google Analytics | AVAILABLE |
HTTP Header Analysis
Following is the HTTP Header Analyis of www.automaticfiresprinklersvc.com
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| automaticfiresprinklersvc.com | A | 3597 | IP : 199.34.228.59 |
| automaticfiresprinklersvc.com | NS | 3597 | Target : ns34.domaincontrol.com |
| automaticfiresprinklersvc.com | NS | 3597 | Target : ns33.domaincontrol.com |
| www.automaticfiresprinklersvc.com | CNAME | 3597 | |
| automaticfiresprinklersvc.com | SOA | 3597 |
MNAME : ns33.domaincontrol.com RNAME : dns.jomax.net Serial : 2016050400 Refresh : 28800 Retry : 7200 Expire : 604800 Minimum TTL : 600 |
| automaticfiresprinklersvc.com | MX | 3597 | Target : smtp.secureserver.net |
| automaticfiresprinklersvc.com | MX | 3597 | Target : mailstore1.secureserver.net |
| automaticfiresprinklersvc.com | TXT | 3597 | Text : google-site-verification=vLYC_SE9o0XHandZXA7WKNkHCPHeWS8IloqpT-T0EWg |