www.altenpflegeheim-schweikershain.de - Detailed Indepth Information and Report for www.altenpflegeheim-schweikershain.de server location, www.altenpflegeheim-schweikershain.de website speed, www.altenpflegeheim-schweikershain.de website DNS lookup, www.altenpflegeheim-schweikershain.de Domain Details,www.altenpflegeheim-schweikershain.de social account information, etc. Complete Analysis of www.altenpflegeheim-schweikershain.de SEO like Meta Tags, Meta Keywords, Description, image count etc.

Web Analysis for altenpflegeheim-schweikershain - www.altenpflegeheim-schweikershain.de

Page URL : https://www.altenpflegeheim-schweikershain.de/
Page Download Size : 117.7285 Kb
Page Load Time : 0.0233 Sec
Download Speed : 4.9343 Mbps

During our test, www.altenpflegeheim-schweikershain.de was downloaded in 0.0233 seconds. The homepage of the website is of 117.7285 Kb. The homepage was downloaded at the speed of 4.9343 Mbps, which is on the lower side.

Website Rank & Score to altenpflegeheim-schweikershain.de by Global & Country

The AuraStats, which measures best global as well country Alexa ranking performace of www.altenpflegeheim-schweikershain.de. www.altenpflegeheim-schweikershain.de ranks is not applicable. www.altenpflegeheim-schweikershain.de is not a top rated website as per Alexa Ranking. The website www.altenpflegeheim-schweikershain.de does not rank amongst top 1 million websites globally or in its country.

Global Alexa Rank

Not Applicable

Country Alexa Rank

Not Applicable

Web Server Information - www.altenpflegeheim-schweikershain.de

altenpflegeheim-schweikershain.de is hosted on Server 185.62.149.42 in COSIMO Vertriebs und Beratungs GmbH Data Center. Approximate latitude and logitude of the IP 185.62.149.42 are 51.057189941406 and 12.557459831238 respectively. altenpflegeheim-schweikershain.de is hosted in Frohburg, Sachsen, Germany.

Hosted IP Address

185.62.149.42

Hosted Country

Germany

Location Latitude

51.057189941406

Location Longitude

12.557459831238

Server ISP

COSIMO Vertriebs und Beratungs GmbH

Server Region

Sachsen

Server City

Frohburg

Page Title of www.altenpflegeheim-schweikershain.de

Altenpflegeheim Schweikershain gGmbH |

Meta Tags of www.altenpflegeheim-schweikershain.de

Upon analysing the homepage of www.altenpflegeheim-schweikershain.de, we found that no meta keywords were present.

Meta Generator of www.altenpflegeheim-schweikershain.de is WordPress 5.5.4.

Meta Viewport of www.altenpflegeheim-schweikershain.de is Mobile Optimized.

We could not find Meta Author, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.altenpflegeheim-schweikershain.de

Meta Keywords

Not Applicable

Meta Author

Not Applicable

Meta Generator

WordPress 5.5.4

Meta Viewport

Mobile Optimized

Meta Framework

Not Applicable

Meta Theme Color

Not Applicable

Meta MS-App

Not Applicable

Meta Format Detection

Not Applicable

Social Accounts

We could not find Facebook URL, Youtube URL, Instagram URL, Lindedin URL for www.altenpflegeheim-schweikershain.de

Facebook Link
Not Available
Youtube Link
Not Available
Instagram Link
Not Available
Linkedin Link
Not Available

Contact Information - altenpflegeheim-schweikershain.de

Mobile No
We could not find any Mobile No. for altenpflegeheim-schweikershain.de
Email ID
We found the some Email ID for altenpflegeheim-schweikershain.de are as follows.
altenpflegeheim@lmkgmbh.de

Domain TYPOS

Some common domain name typos of altenpflegeheim-schweikershain.de are as follows:

Website Inpage Analysis

We didn't find any H5 Tags, H6 Tags, Iframe Tags, Audio Tags, Video Tags, Google Adsense, Google Analytics on altenpflegeheim-schweikershain.de, however, there are 4 H1 Tags, 1 H2 Tags, 25 H3 Tags, 2 H4 Tags, 21 Paragraph Tags, 16 Image Tags, 85 Div Tags.

H1 Heading

4

H3 Heading

25

H5 Heading

Not Applicable

P Tag

21

Total IFRAMEs

Not Applicable

Audio

Not Applicable

Google Adsense

Not Applicable

H2 Heading

1

H4 Heading

2

H6 Heading

Not Applicable

Total Images

16

Div Tag

85

Video

Not Applicable

Google Analytics

Not Applicable

HTTP Header Analysis

Following is the HTTP Header Analyis of www.altenpflegeheim-schweikershain.de

DNS Record Analysis

Host Type TTL Extra
www.altenpflegeheim-schweikershain.de A 86390 IP : 185.62.149.42