www.altenpflegeheim-schweikershain.de - Detailed Indepth Information and Report for www.altenpflegeheim-schweikershain.de server location, www.altenpflegeheim-schweikershain.de website speed, www.altenpflegeheim-schweikershain.de website DNS lookup, www.altenpflegeheim-schweikershain.de Domain Details,www.altenpflegeheim-schweikershain.de social account information, etc. Complete Analysis of www.altenpflegeheim-schweikershain.de SEO like Meta Tags, Meta Keywords, Description, image count etc.
Web Analysis for altenpflegeheim-schweikershain - www.altenpflegeheim-schweikershain.de
| Page URL : | https://www.altenpflegeheim-schweikershain.de/ |
|---|---|
| Page Download Size : | 117.7285 Kb |
| Page Load Time : | 0.0233 Sec |
| Download Speed : | 4.9343 Mbps |
During our test, www.altenpflegeheim-schweikershain.de was downloaded in 0.0233 seconds. The homepage of the website is of 117.7285 Kb. The homepage was downloaded at the speed of 4.9343 Mbps, which is on the lower side.
Website Rank & Score to altenpflegeheim-schweikershain.de by Global & Country
The AuraStats, which measures best global as well country Alexa ranking performace of www.altenpflegeheim-schweikershain.de. www.altenpflegeheim-schweikershain.de ranks is not applicable. www.altenpflegeheim-schweikershain.de is not a top rated website as per Alexa Ranking. The website www.altenpflegeheim-schweikershain.de does not rank amongst top 1 million websites globally or in its country.
| Global Alexa Rank | Not Applicable |
|---|---|
| Country Alexa Rank | Not Applicable |
Web Server Information - www.altenpflegeheim-schweikershain.de
altenpflegeheim-schweikershain.de is hosted on Server 185.62.149.42 in COSIMO Vertriebs und Beratungs GmbH Data Center. Approximate latitude and logitude of the IP 185.62.149.42 are 51.057189941406 and 12.557459831238 respectively. altenpflegeheim-schweikershain.de is hosted in Frohburg, Sachsen, Germany.
| Hosted IP Address | 185.62.149.42 |
|---|---|
| Hosted Country | Germany |
| Location Latitude | 51.057189941406 |
| Location Longitude | 12.557459831238 |
| Server ISP | COSIMO Vertriebs und Beratungs GmbH |
| Server Region | Sachsen |
| Server City | Frohburg |
Page Title of www.altenpflegeheim-schweikershain.de
Altenpflegeheim Schweikershain gGmbH |
Meta Tags of www.altenpflegeheim-schweikershain.de
Upon analysing the homepage of www.altenpflegeheim-schweikershain.de, we found that no meta keywords were present.
Meta Generator of www.altenpflegeheim-schweikershain.de is WordPress 5.5.4.
Meta Viewport of www.altenpflegeheim-schweikershain.de is Mobile Optimized.
We could not find Meta Author, Meta Framework, Meta Theme-Color, Meta Ms-App, Meta Format Detection for www.altenpflegeheim-schweikershain.de
| Meta Keywords | Not Applicable |
|---|---|
| Meta Author | Not Applicable |
| Meta Generator | WordPress 5.5.4 |
| Meta Viewport | Mobile Optimized |
| Meta Framework | Not Applicable |
| Meta Theme Color | Not Applicable |
| Meta MS-App | Not Applicable |
| Meta Format Detection | Not Applicable |
Social Accounts
We could not find Facebook URL, Youtube URL, Instagram URL, Lindedin URL for www.altenpflegeheim-schweikershain.de
| Facebook Link |
|---|
| Not Available |
| Youtube Link |
| Not Available |
| Instagram Link |
| Not Available |
| Linkedin Link |
| Not Available |
Contact Information - altenpflegeheim-schweikershain.de
| Mobile No |
|---|
| We could not find any Mobile No. for altenpflegeheim-schweikershain.de |
| Email ID |
|---|
| We found the some Email ID for altenpflegeheim-schweikershain.de are as follows. |
| altenpflegeheim@lmkgmbh.de |
Domain TYPOS
Some common domain name typos of altenpflegeheim-schweikershain.de are as follows:
Website Inpage Analysis
We didn't find any H5 Tags, H6 Tags, Iframe Tags, Audio Tags, Video Tags, Google Adsense, Google Analytics on altenpflegeheim-schweikershain.de, however, there are 4 H1 Tags, 1 H2 Tags, 25 H3 Tags, 2 H4 Tags, 21 Paragraph Tags, 16 Image Tags, 85 Div Tags.
| H1 Heading | 4 |
|---|---|
| H3 Heading | 25 |
| H5 Heading | Not Applicable |
| P Tag | 21 |
| Total IFRAMEs | Not Applicable |
| Audio | Not Applicable |
| Google Adsense | Not Applicable |
| H2 Heading | 1 |
|---|---|
| H4 Heading | 2 |
| H6 Heading | Not Applicable |
| Total Images | 16 |
| Div Tag | 85 |
| Video | Not Applicable |
| Google Analytics | Not Applicable |
HTTP Header Analysis
Following is the HTTP Header Analyis of www.altenpflegeheim-schweikershain.de
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| www.altenpflegeheim-schweikershain.de | A | 86390 | IP : 185.62.149.42 |